$38.00 - $49.00
Min. Order : 10 Milligrams

Hot selling research use Medicine Grade peptide FOXO4-DRI

Get Latest Price
Trade Assurance
Built-in order protection service in alibaba.com
Product quality
On-time shipment
More on shipping and other trade services.

Quick Details

Port: Shanghai;HK
Payment Terms: L/C,T/T,Western Union,MoneyGram
Supply Ability: 10 Gram/Grams per Month
Other Names: FOX04 DRI powder
Place of Origin: Shanghai China
Grade Standard: Medicine Grade
Sample: Availiable
Product Name: FOX04 DRI
Purity: 98%min
Shelf life: 2 Years
Appearance: White Lyophilized Powder
MOQ: 10 miligrams
CAS No.: N/A
Brand Name: zhong&fa
Type: Pharmaceutical Intermediates
EINECS No.: N/A
MF: C147H238N44O42S
Application: Anti-wrinkle
Package Preview: https://sc04.alicdn.com/kf/H4886c009772048558bd7463f32bce813X.jpg_640x640.jpg,https://sc04.alicdn.com/kf/Ha617c51c6bf243f7b1d8e33aa4c9e4fbu.jpg_640x640.jpg
Shanghai Zhongfa Information Technology Co., Ltd.
Gold Supplier
CN
Trading Company
≤5h
Response Time
100.0%
On-time delivery rate
US$ 10,000+
26
Transactions
Visit Store
Products Description
FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.
FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.
item
value
CAS No.
N/A
Other Names
FOX04 DRI powder
MF
C147H238N44O42S
EINECS No.
N/A
Place of Origin
China
Type
Pharmaceutical Intermediates
Grade Standard
Medicine Grade
Brand Name
zhong&fa
Purity
98%min
Product Name
FOX04 DRI
Appearance
White Lyophilized Powder
Application
Anti-wrinkle
Sample
Availiable
MOQ
10 miligrams
Shelf life
2 Years
Products Specification
Product Name
FOX04 DRI
Identification
Positive
Ratio Absorbances
A361nm/A278nm: 1.70-1.90
A361nm/A550nm: 3.15-3.40
Pseudo Cyanocobalamin
Complies
Loss on drying
≤12.0%
Assay on dried
96.0~100.5%
Bacteria
≤1000cfu/g
Mould,Yeasts
≤100cfu/g
E Coli
No found
Limit of residual solvents
Acetone≤0.5%
Company Profile
Shanghai zhongfa information technology Co.,Ltd, located in shanghai , is a technology-driven and forward-looking company,experience in nutrition industry. We are committed to providing our clients high quality nootropics, herbal extract, healthcare and fitness ingredients,nutritional chemicals, APIS and peptides and so on
Shanghai zhongfa information technology Co.,Ltd, has four modern production bases in china, all factories are built strictly under GMP requirements. Meanwhile we have two well-equipped laboratories together with professional technical and R&D teams, which not only enable us offer high-quality products, but also make zhongfa always stand in the forefront in the field.
Production Process
Certificate Display
Company Exhibition
Packing & Delivery
Package:1kg/aluminum foil bag;25Kgs in fiber-drums with two-plastic bags inside
Net Weight:25kgs/Drum/Gross Weight:28kgs/Drum
Drum Size & Volume:I.D.42cm × H52cm,0.08 m³/Drum
Storage:Stored in dry and cool place,keep away from strong light and heat.
Shelf Life:Two years when properly stored.
Professional and Various shipping way
100% Quality Control 100% Payment Safty
100% On-time Shipment
100% After Sales Service
FAQ
Q:Can I get some samples?
A:Yes, we can supply the free sample, but the shipping cost be paid by customer.
Q:How to confirm the Product Quality before placing orders?
A:We offer free sample,After you test the sample,you can know our quality.then place order.
Q:Can you guarantee I can get my goods without any custom problem?
A:Yes, We have Reship Service.You can get your goods without any problem.
Q:When you ship my order?
A:Normally within 3 to 5 days after confirming your payment
Q:How do you hide the products?
A:Our shipping worker is very professional.They can pack various professional discreet package for hidding the products
Q. who are we?
We are based in Shanghai, China, start from 2018,sell to North America(45.00%),Northern Europe(10.00%),Central
America(10.00%),Western Europe(10.00%),Mid East(10.00%),Eastern Europe(10.00%),Domestic Market(5.00%). There are total about 11-50 people in our office.
Q. how can we guarantee quality?
Always a pre-production sample before mass production;
Always final Inspection before shipment;
Q.what can you buy from us?
nootropics,Natural nutritions,peptides,cosmetic raw materials,health and fitness products ingredients
Q. why should you buy from us not from other suppliers?
Shanghai zhongfa is mainly dealing with nootropis raw powder,peptides , herbal extracts, cosmetic raw materiarals ,healthcare ingredient, fitness products, and natural nutritions. Best quality, best service and best price.
Q. what services can we provide?
Accepted Delivery Terms: FOB,CFR,CIF,EXW,FCA,Express Delivery;
Accepted Payment Currency:USD,EUR,JPY,CAD,AUD,GBP,CHF;
Accepted Payment Type: T/T,L/C,MoneyGram,Credit Card,Western Union;
Language Spoken:English,Chinese